PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG004274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 216aa    MW: 23512.7 Da    PI: 6.4869
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG004274.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13.2e-43631621100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++lq+q++ l+a+la+++
  CCG004274.1  63 PCAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAISQLQKQVSDLQAQLAKAQ 160
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  CCG004274.1 161 AE 162
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.05862163IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4363160IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MDMSAAISPI NVPSQFSYSP SSSSPPSSHH SSPTTFPSPS KSSPNLTPPS AATPLPPPAV  60
VSPCAACKIL RRRCVDKCVL APYFPPSEPY KFTIAHRVFG ASNIIKFLQE LPESQRADAV  120
SSMVYEANAR IRDPVYGCAG AISQLQKQVS DLQAQLAKAQ AEVVNMQCQQ ANLVALLCME  180
MTQSQQEPIL QQHQYVDTSC FLDENNLGTS WEPLWT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2841650.0HQ284165.1 Populus tremula x Populus alba lateral organ boundaries domain 1 (LBD1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027000.11e-158PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLE7DP381e-125E7DP38_POPCN; Lateral organ boundaries domain 1
STRINGPOPTR_0008s04350.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-68LOB domain-containing protein 1